Kindlin Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP189883

Catalog No. NBP189883

Description

Kindlin Polyclonal specifically detects Kindlin in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Kindlin
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: FERMT1
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:ADSLLEDITDIPKLADNLKLFRPKKLLPKAFKQYWFIFKDTSIAYFKNKELEQGEPL
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 0.2mg/mL
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: C20orf42fermitin family homolog 1, chromosome 20 open reading frame 42, fermitin family homolog 1 (Drosophila), fermitin family member 1, FLJ20116, KIND1DTGCU2, kindlerin, kindlin 1, Kindlin syndrome protein, Kindlin-1, UNC112 related protein 1, UNC112A, Unc-112-related protein 1, URP1FLJ23423
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 55612
• Target Species: Human
• Isotype: IgG

For Research Use Only