Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Kinesin 5A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $646.00
Specifications
Antigen | Kinesin 5A |
---|---|
Applications | Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
Kinesin 5A Polyclonal specifically detects Kinesin 5A in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
Kinesin 5A | |
Polyclonal | |
Rabbit | |
Cytoskeleton Markers | |
D12S1889, KIF5A variant protein, kinesin family member 5A, kinesin heavy chain isoform 5A, Kinesin heavy chain neuron-specific 1, kinesin, heavy chain, neuron-specific, MY050, Neuronal kinesin heavy chain, NKHC1, NKHCspastic paraplegia 10 (autosomal dominant), SPG10 | |
KIF5A | |
IgG | |
Affinity Purified |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
Human | |
3798 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RLQEVSGHQRKRIAEVLNGLMKDLSEFSVIVGNGEIKLPVEISGAIEEEFT | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title