Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Kinesin C2 Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP15824720UL

 View more versions of this product

Catalog No. NBP15824720


Only null left
Add to Cart

Description

Description

Kinesin C2 Polyclonal specifically detects Kinesin C2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications

Specifications

Kinesin C2
Polyclonal
Western Blot 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Q96AC6
KIFC2
Synthetic peptides corresponding to KIFC2 (kinesin family member C2) The peptide sequence was selected from the N terminal of KIFC2. Peptide sequence VRPPSPDGSTSQEESPSHFTAVPGEPLGDETQGQQPLQLEEDQRAWQRLE.
20 μL
Cytoskeleton Markers, Vision
90990
Store at -20C. Avoid freeze-thaw cycles.
IgG
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
kinesin family member C2, kinesin-like protein KIFC2
Rabbit
Protein A purified
RUO
Primary
Human
Purified
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Product Certifications
Promotions

Promotions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.