Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Kinesin C2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$158.00 - $487.50
Specifications
| Antigen | Kinesin C2 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15824720
|
Novus Biologicals
NBP15824720UL |
20 μL |
Each for $158.00
|
|
|||||
|
NBP158247
|
Novus Biologicals
NBP158247 |
100 μL |
Each for $487.50
|
|
|||||
Description
Kinesin C2 Polyclonal specifically detects Kinesin C2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| Kinesin C2 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Q96AC6 | |
| 90990 | |
| Synthetic peptides corresponding to KIFC2 (kinesin family member C2) The peptide sequence was selected from the N terminal of KIFC2. Peptide sequence VRPPSPDGSTSQEESPSHFTAVPGEPLGDETQGQQPLQLEEDQRAWQRLE. | |
| Primary |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Cytoskeleton Markers, Vision | |
| kinesin family member C2, kinesin-like protein KIFC2 | |
| KIFC2 | |
| IgG | |
| Protein A purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title