Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
KIR3DL2/CD158k Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP309425100UL
Description
KIR3DL2/CD158k Polyclonal specifically detects KIR3DL2/CD158k in Human samples. It is validated for Western Blot.Specifications
KIR3DL2/CD158k | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
killer cell immunoglobulin-like receptor 3DL2, CD158K, killer cell immunoglobulin-like receptor, three domains, long cytoplasmic tail, 2, NKAT4, NKAT-4, NKAT4B, p140 | |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human KIR3DL2/CD158k (NP_006728). Peptide sequence LFILLLFFLLYRWCSNKKNAAVMDQEPAGDRTVNRQDSDEQDPQEVTYAQ | |
100 μg | |
Primary | |
Human | |
Purified |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
3812 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction