Kir6.2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP233540

Catalog No. NBP233540

Description

Kir6.2 Polyclonal specifically detects Kir6.2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Kir6.2
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
• Gene Accession No.: Q14654
• Gene Symbols: KCNJ11
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: TVKVPTPLCTARQLDEDHSLLEALTLASARGPLRKRSVPMAKAKPKFSISPDSLS
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: ATP-sensitive inward rectifier potassium channel 11, beta-cell inward rectifier subunit, BIRKIR6.2, HHF2, IKATP, Inward rectifier K(+) channel Kir6.2, inwardly rectifying potassium channel KIR6.2, Kir6.2, MGC133230, PHHI, potassium channel inwardly rectifing subfamily J member 11, Potassium channel, inwardly rectifying subfamily J member 11, potassium inwardly-rectifying channel, subfamily J, member 11, TNDM3
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 3767
• Target Species: Human
• Isotype: IgG

For Research Use Only