Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
KLC3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | KLC3 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
KLC3 Polyclonal specifically detects KLC3 in Human samples. It is validated for Western Blot.Specifications
KLC3 | |
Polyclonal | |
Rabbit | |
Q6P597 | |
147700 | |
Synthetic peptides corresponding to KLC3(kinesin light chain 3) The peptide sequence was selected from the middle region of KLC3 (NP_8031360). Peptide sequence MLNILALVYRDQNKYKEATDLLHDALQIREQTLGPEHPAVAATLNNLAVL. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
kinesin light chain 3, KLC2, KLC2-like, KLC2Lkinesin light chain 2, KLCt, KNS2B | |
KLC3 | |
IgG | |
55 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title