KLF8 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Supplier:  Novus Biologicals NBP25774025UL

Catalog No. NB403387

Description

KLF8 Polyclonal specifically detects KLF8 in Human, Mouse samples. It is validated for Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: KLF8
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin
• Gene Alias: Basic krueppel-like factor 3, basic kruppel-like factor 3, BKLF3DKFZp686O08126, DXS741, Krueppel-like factor 8, Kruppel-like factor 8, Zinc finger protein 741, ZNF741MGC138314
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 11279
• Target Species: Human, Mouse
• Isotype: IgG

• Applications: Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: KLF8
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PALFNDIKIEPPEELLASDFSLPQVEPVDLSFHKPKAPLQPASMLQAPIRPPKPQSSPQ
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

For Research Use Only