Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
KLHDC1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | KLHDC1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
KLHDC1 Polyclonal specifically detects KLHDC1 in Human samples. It is validated for Western Blot.Specifications
KLHDC1 | |
Polyclonal | |
Rabbit | |
Q8N7A1 | |
122773 | |
Synthetic peptides corresponding to KLHDC1(kelch domain containing 1) The peptide sequence was selected from the N terminal of KLHDC1. Peptide sequence IDSGLWRMHLMEGELPASMSGSCGACINGKLYIFGGYDDKGYSNRLYFVN. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
kelch domain containing 1, kelch domain-containing protein 1, MGC126644, MGC126646, MST025 | |
KLHDC1 | |
IgG | |
47 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title