Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
KLHDC1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | KLHDC1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP155193
|
Novus Biologicals
NBP155193 |
100 μL |
Each for $436.00
|
|
NBP15519320
|
Novus Biologicals
NBP15519320UL |
20 μL | This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. | N/A |
Description
KLHDC1 Polyclonal specifically detects KLHDC1 in Human samples. It is validated for Western Blot.Specifications
KLHDC1 | |
Polyclonal | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
kelch domain containing 1, kelch domain-containing protein 1, MGC126644, MGC126646, MST025 | |
KLHDC1 | |
IgG | |
Affinity Purified | |
47 kDa |
Western Blot | |
Unconjugated | |
RUO | |
Q8N7A1 | |
122773 | |
Synthetic peptides corresponding to KLHDC1(kelch domain containing 1) The peptide sequence was selected from the N terminal of KLHDC1. Peptide sequence IDSGLWRMHLMEGELPASMSGSCGACINGKLYIFGGYDDKGYSNRLYFVN. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title