Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
KLHDC5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | KLHDC5 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
KLHDC5 Polyclonal specifically detects KLHDC5 in Human samples. It is validated for Western Blot.Specifications
KLHDC5 | |
Polyclonal | |
Rabbit | |
NP_065833 | |
57542 | |
Synthetic peptide directed towards the middle region of human KLHDC5. Peptide sequence IVGGCLHELGPNRRSSQSEDMLTVQSYNTVTRQWLYLKENTSKSGLNLTC. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
Ctb9, kelch domain containing 5, kelch domain-containing protein 5, KIAA1340, MGC131714 | |
KLHDC5 | |
IgG | |
57 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title