Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
KLHDC8B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | KLHDC8B |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
KLHDC8B Polyclonal specifically detects KLHDC8B in Human samples. It is validated for Western Blot.Specifications
KLHDC8B | |
Polyclonal | |
Rabbit | |
FLJ11302, FP17659, kelch domain containing 8B | |
KLHDC8B | |
IgG | |
38 kDa |
Western Blot | |
Unconjugated | |
RUO | |
200942 | |
Synthetic peptides corresponding to KLHDC8B(kelch domain containing 8B) The peptide sequence was selected from the N terminal of KLHDC8B. Peptide sequence MSAGGGRAFAWQVFPPMPTCRVYGTVAHQDGHLLVLGGCGRAGLPLDTAE. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title