Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
KLHL14 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP18004820UL
Description
KLHL14 Polyclonal specifically detects KLHL14 in Human samples. It is validated for Western Blot.Specifications
KLHL14 | |
Polyclonal | |
Western Blot 1:1000 | |
NP_065856 | |
KLHL14 | |
Synthetic peptide directed towards the N terminal of human KLHL14. Peptide sequence MSRSGDRTSTFDPSHSDNLLHGLNLLWRKQLFCDVTLTAQGQQFHCHKAV. | |
Protein A purified | |
RUO | |
57565 | |
Store at -20C. Avoid freeze-thaw cycles. | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
kelch-like 14 (Drosophila), kelch-like protein 14, KIAA1384, printor | |
Rabbit | |
71 kDa | |
20 μL | |
Primary | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction