KLHL20 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179570

Catalog No. NBP179570

Description

KLHL20 Polyclonal specifically detects KLHL20 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: KLHL20
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Kelch motif containing protein, kelch-like 20 (Drosophila), kelch-like ECT2 interacting protein, Kelch-like ECT2-interacting protein, kelch-like protein 20, Kelch-like protein X, KHLHX, KLEIPRP3-383J4.3, KLHLX
• Host Species: Rabbit
• Molecular Weight of Antigen: 68 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Zebrafish: 100%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_055273
• Gene Symbols: KLHL20
• Immunogen: Synthetic peptide directed towards the C terminal of human KLHL20The immunogen for this antibody is KLHL20. Peptide sequence NPQENRWHTIAPMGTRRKHLGCAVYQDMIYAVGGRDDTTELSSAERYNPR.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 27252
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.