Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
KLHL20 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP17957020UL
Description
KLHL20 Polyclonal specifically detects KLHL20 in Human samples. It is validated for Western Blot.Specifications
KLHL20 | |
Polyclonal | |
Western Blot 1:1000 | |
NP_055273 | |
KLHL20 | |
Synthetic peptide directed towards the C terminal of human KLHL20The immunogen for this antibody is KLHL20. Peptide sequence NPQENRWHTIAPMGTRRKHLGCAVYQDMIYAVGGRDDTTELSSAERYNPR. | |
Affinity Purified | |
RUO | |
27252 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
Kelch motif containing protein, kelch-like 20 (Drosophila), kelch-like ECT2 interacting protein, Kelch-like ECT2-interacting protein, kelch-like protein 20, Kelch-like protein X, KHLHX, KLEIPRP3-383J4.3, KLHLX | |
Rabbit | |
68 kDa | |
20 μL | |
Primary | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction