Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. KLHL20 Antibody, Novus Biologicals™

KLHL20 Antibody, Novus Biologicals™
SDP

Catalog No. NBP17957020 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP17957020 20 μL
NBP179570 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP17957020 Supplier Novus Biologicals Supplier No. NBP17957020UL

Description

Rabbit Polyclonal Antibody

KLHL20 Polyclonal specifically detects KLHL20 in Human samples. It is validated for Western Blot.

Specifications

Antigen KLHL20
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:1000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. NP_055273
Gene Alias Kelch motif containing protein, kelch-like 20 (Drosophila), kelch-like ECT2 interacting protein, Kelch-like ECT2-interacting protein, kelch-like protein 20, Kelch-like protein X, KHLHX, KLEIPRP3-383J4.3, KLHLX
Gene Symbols KLHL20
Host Species Rabbit
Immunogen Synthetic peptide directed towards the C terminal of human KLHL20The immunogen for this antibody is KLHL20. Peptide sequence NPQENRWHTIAPMGTRRKHLGCAVYQDMIYAVGGRDDTTELSSAERYNPR.
Molecular Weight of Antigen 68 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 27252
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.