Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
KLHL20 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$208.00 - $501.50
Specifications
| Antigen | KLHL20 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP17957020
|
Novus Biologicals
NBP17957020UL |
20 μL |
Each for $208.00
|
|
|||||
|
NBP179570
|
Novus Biologicals
NBP179570 |
100 μL |
Each for $501.50
|
|
|||||
Description
KLHL20 Polyclonal specifically detects KLHL20 in Human samples. It is validated for Western Blot.Specifications
| KLHL20 | |
| Polyclonal | |
| Rabbit | |
| NP_055273 | |
| 27252 | |
| Synthetic peptide directed towards the C terminal of human KLHL20The immunogen for this antibody is KLHL20. Peptide sequence NPQENRWHTIAPMGTRRKHLGCAVYQDMIYAVGGRDDTTELSSAERYNPR. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Kelch motif containing protein, kelch-like 20 (Drosophila), kelch-like ECT2 interacting protein, Kelch-like ECT2-interacting protein, kelch-like protein 20, Kelch-like protein X, KHLHX, KLEIPRP3-383J4.3, KLHLX | |
| KLHL20 | |
| IgG | |
| 68 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title