Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

KLHL24 Antibody, Novus Biologicals™
SDP

Catalog No. NBP237705 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP237705 0.1 mL
NB413870 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP237705 Supplier Novus Biologicals Supplier No. NBP237705
Only null left
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

KLHL24 Polyclonal specifically detects KLHL24 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen KLHL24
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:10000 - 1:20000
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. Q6TFL4
Gene Alias DRE1, Kainate Receptor Interacting Protein For GluR6, Kainate Receptor-Interacting Protein For GluR6, Kelch-Like 24, Kelch-Like 24 (Drosophila), Kelch-Like Family Member 24, Kelch-Like Protein 24, KLHL24 KRIP6, Protein DRE1
Gene Symbols KLHL24
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: MVLILGRRLNREDLGVRDSPATKRKVFEMDPKSLTGHEFFDFSSGSSHAENILQIFNEFRDSRLFTDVIICVEG
Purification Method Affinity Purified
Quantity 0.1 mL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 54800
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.