KLHL24 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP237705

Catalog No. NBP237705

Description

KLHL24 Polyclonal specifically detects KLHL24 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: KLHL24
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:10000 - 1:20000
• Gene Accession No.: Q6TFL4
• Gene Symbols: KLHL24
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: MVLILGRRLNREDLGVRDSPATKRKVFEMDPKSLTGHEFFDFSSGSSHAENILQIFNEFRDSRLFTDVIICVEG
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: DRE1, Kainate Receptor Interacting Protein For GluR6, Kainate Receptor-Interacting Protein For GluR6, Kelch-Like 24, Kelch-Like 24 (Drosophila), Kelch-Like Family Member 24, Kelch-Like Protein 24, KLHL24 KRIP6, Protein DRE1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 54800
• Target Species: Human
• Isotype: IgG