Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
KLHL35 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$480.74
Specifications
| Antigen | KLHL35 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
KLHL35 Polyclonal specifically detects KLHL35 in Human samples. It is validated for Western Blot.Specifications
| KLHL35 | |
| Polyclonal | |
| Rabbit | |
| NP_001034637 | |
| 283212 | |
| Synthetic peptide directed towards the N terminal of human FLJ33790The immunogen for this antibody is FLJ33790. Peptide sequence RPRRFMDLAEVIVVIGGCDRKGLLKLPFADAYHPESQRWTPLPSLPGYTR. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| FLJ33790, kelch-like 35 (Drosophila) | |
| KLHL35 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title