Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
KLRG1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $646.00
Specifications
Antigen | KLRG1 |
---|---|
Applications | Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
KLRG1 Polyclonal specifically detects KLRG1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
KLRG1 | |
Polyclonal | |
Rabbit | |
Immunology, Innate Immunity, Signal Transduction | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
10219 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LCQGSNYSTCASCPSCPDRWMKYGNHCYYFSVEEKDWNSSLEFCLARDSHLLVITDNQEMSLLQVFLSE | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
Human | |
2F1, CLEC15AMAFA-LIKE, C-type lectin domain family 15 member A, C-type lectin domain family 15, member A, ITIM-containing receptor MAFA-L, killer cell lectin-like receptor subfamily G member 1, killer cell lectin-like receptor subfamily G, member 1, MAFAL, MAFA-L, MAFA-like receptor, MAFAMAFA-2F1, Mast cell function-associated antigen, mast cell function-associated antigen (ITIM-containing), MGC13600 | |
KLRG1 | |
IgG | |
Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title