Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
KMT2A/MLL Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$382.00 - $648.50
Specifications
| Antigen | KMT2A/MLL |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
KMT2A/MLL Polyclonal specifically detects KMT2A/MLL in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| KMT2A/MLL | |
| Polyclonal | |
| Rabbit | |
| Transcription Factors and Regulators | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 4297 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPRSGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKED | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| ALL1, ALL-1MLL/GAS7, CXXC7TET1-MLL, CXXC-type zinc finger protein 7, EC 2.1.1.43, HRXFLJ11783, HTRX, HTRX1MLL-AF4 der(11) fusion protein, KMT2ACDK6/MLL fusion protein, Lysine N-methyltransferase 2A, MLL/GAS7 fusion protein, MLL/GMPS fusion protein, MLL1, MLL1A, myeloid/lymphoid or mixed-lineage leukemia (trithorax (Drosophila) homolog), myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila), Trithorax-like protein, TRX1histone-lysine N-methyltransferase MLL, Zinc finger protein HRX | |
| MLL | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title