Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
KOX2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP17944920UL
Description
KOX2 Polyclonal specifically detects KOX2 in Human samples. It is validated for Western Blot.Specifications
KOX2 | |
Polyclonal | |
Western Blot 1:1000 | |
EAW85891 | |
ZNF33A | |
The specific Immunogen is proprietary information. Peptide sequence LQKGDKGEKHFECNECGKAFWEKSHLTRHQRVHTGQKPFQCNECEKAFWD. | |
20 μL | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
KOX2, KOX31, zinc finger protein 11A, zinc finger protein 33A, zinc finger protein KOX31, ZNF11, ZZAPK | |
Rabbit | |
Affinity Purified | |
RUO | |
7581 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction