Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. KOX2 Antibody, Novus Biologicals™

KOX2 Antibody, Novus Biologicals™
SDP

Catalog No. NBP17944920 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP17944920 20 μL
NBP179449 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP17944920 Supplier Novus Biologicals Supplier No. NBP17944920UL

Description

Rabbit Polyclonal Antibody

KOX2 Polyclonal specifically detects KOX2 in Human samples. It is validated for Western Blot.

Specifications

Antigen KOX2
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:1000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. EAW85891
Gene Alias KOX2, KOX31, zinc finger protein 11A, zinc finger protein 33A, zinc finger protein KOX31, ZNF11, ZZAPK
Gene Symbols ZNF33A
Host Species Rabbit
Immunogen The specific Immunogen is proprietary information. Peptide sequence LQKGDKGEKHFECNECGKAFWEKSHLTRHQRVHTGQKPFQCNECEKAFWD.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 7581
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.