Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
KRT84 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | KRT84 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
KRT84 Polyclonal specifically detects KRT84 in Human samples. It is validated for Western Blot.Specifications
KRT84 | |
Polyclonal | |
Rabbit | |
hair, basic, 4, hard keratin, type II, 4, K84, keratin 84, keratin, type II cuticular Hb4, keratin-84, KRTHB4, type II hair keratin Hb4 | |
KRT84 | |
IgG |
Western Blot | |
Unconjugated | |
RUO | |
3890 | |
Synthetic peptides corresponding to KRT84(keratin 84) The peptide sequence was selected from the middle region of KRT84. Peptide sequence ESYITNLRRQLEVLVSDQARLQAERNHLQDVLEGFKKKYEEEVVCRANAE. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title