Invitrogen™ Ku70 Monoclonal Antibody (3D7)

Catalog No.	Quantity
PIMA549208	100 μg

Catalog No. PIMA549208 Supplier Invitrogen™ Supplier No. MA549208

Description

Mouse Monoclonal Antibody

Adding 0.2 mL of distilled water will yield a concentration of 500 μg/mL. Immunogen sequence is different from the related mouse sequence by one amino acid. Positive Control - WB: human Hela whole cell, human A549 whole cell, human HepG2 whole cell, human MCF-7 whole cell. IHC: human renal clear cell carcinoma tissue, human ovarian serous adenocarcinoma tissue, human adrenocortical adenoma tissue, human breast cancer tissue, human gallbladder adenocarcinoma tissue, human rectal cancer tissue. ICC/IF: U20S cell. Flow: THP-1 cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

XRCC6 is a nuclear complex consisting of two subunits with molecular masses of approximately 70 and 80 kDa. The complex functions as a single-stranded DNA-dependent ATP-dependent helicase. The complex may be involved in the repair of nonhomologous DNA ends such as that required for double-strand break repair, transposition, and V(D)J recombination. High levels of autoantibodies to p70 and p80 have been found in some patients with systemic lupus erythematosus.

Specifications

• Antigen: Ku70
• Applications: Flow Cytometry, Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry
• Classification: Monoclonal
• Clone: 3D7
• Concentration: 500 μg/mL
• Conjugate: Unconjugated
• Formulation: PBS with 4mg trehalose and no preservative
• Gene: XRCC6
• Gene Accession No.: P12956
• Gene Alias: 5'-deoxyribose-5-phosphate lyase Ku70; 5'-dRP lyase Ku70; 5'-dRP/AP lyase Ku70; 70 kDa subunit of Ku antigen; 70kDa; ATP-dependent DNA helicase 2 subunit 1; ATP-dependent DNA helicase II 70 kDa subunit; ATP-dependent DNA helicase II, 70 kDa subunit; CT; CTA-216E10.7; CTC box binding factor 75 kDa subunit; CTC box-binding factor 75 kDa subunit; CTC75; CTCBF; DNA repair protein XRCC6; G22p1; Ku autoantigen p70 subunit; ku autoantigen protein p70 homolog; Ku autoantigen, 70kDa; Ku p70; Ku70; Ku70 DNA-binding component of DNA-dependent proteinkinase complex (thyroid autoantigen 70 kDa); Kup70; Lupus Ku autoantigen protein p70; ML8; OTTHUMP00000028581; thyroid autoantigen; thyroid autoantigen 70 kDa; thyroid autoantigen 70kD (Ku antigen); thyroid autoantigen 70kDa (Ku antigen); Thyroid-lupus autoantigen; thyroid-lupus autoantigen p70; TLAA; XELAEV_18023498mg; X-ray repair complementing defective repair in Chinese hamster cells 6; X-ray repair complementing defective repair in Chinese hamster cells 6 L homeolog; X-ray repair cross complementing 6; X-ray repair cross-complementing protein 6; xrcc6; xrcc6.L
• Gene Symbols: XRCC6
• Host Species: Mouse
• Immunogen: A synthetic peptide corresponding to a sequence at C-terminus of human Ku70 (464-496aa AIVEKLRFTYRSDSFENPVLQQHFRNLEALALD).
• Purification Method: Antigen affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 2547
• Target Species: Human
• Content And Storage: -20°C
• Product Type: Antibody
• Form: Lyophilized
• Isotype: IgG1