Ku70/XRCC6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP238954

Catalog No. NBP238954

Description

Ku70/XRCC6 Polyclonal specifically detects Ku70/XRCC6 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Ku70/XRCC6
• Classification: Polyclonal
• Dilution: Western Blot 0.04 - 0.4 μg/mL, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Accession No.: P12956
• Gene Symbols: XRCC6
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: DVQFKMSHKRIMLFTNEDNPHGNDSAKASRARTKAGDLRDTGIFLDLMHLKKPGGFDISLFYRDIISIAEDEDLRVHFEESSKLEDLLRKVRAKETR
• Quantity: 0.1 mL
• Research Discipline: Breast Cancer, Cancer, DNA Double Strand Break Repair, DNA Repair, Non homologous end joining
• Gene ID (Entrez): 2547
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: 5'-deoxyribose-5-phosphate lyase Ku70, 5'-dRP lyase Ku70, 70 kDa subunit of Ku antigen, ATP-dependent DNA helicase 2 subunit 1, ATP-dependent DNA helicase II 70 kDa subunit, CTC box binding factor 75 kDa subunit, CTC box-binding factor 75 kDa subunit, CTC75, CTCBF, D22S731, EC 3.6.4.-, EC 4.2.99.-, G22P1Ku70, Ku autoantigen p70 subunit, Ku autoantigen, 70kDa, KU70, ML8,70 kDa subunit, Thyroid-lupus autoantigen, thyroid-lupus autoantigen p70, TLAAD22S671, X-ray repair complementing defective repair in Chinese hamster cells 6DNA repair protein XRCC6, X-ray repair cross-complementing protein 6
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.