Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Ku80/XRCC5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP156408
Description
Ku80/XRCC5 Polyclonal specifically detects Ku80/XRCC5 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| Ku80/XRCC5 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| 80kDa, ATP-dependent DNA helicase 2 subunit 2, ATP-dependent DNA helicase II 80 kDa subunit, CTC85, CTCBF, EC 3.6.4.-, FLJ39089, G22P2, KARP1, KARP-1, KU80, Ku86 autoantigen related protein 1,86 kDa subunit of Ku antigen, Ku86DNA repair protein XRCC5, KUB2, NFIV, Thyroid-lupus autoantigen, TLAA, X-ray repair complementing defective repair in Chinese hamster cells 5(double-strand-break rejoining)CTC box-binding factor 85 kDa subunit, X-ray repair complementing defective repair in Chinese hamster cells 5(double-strand-break rejoining; Ku autoantigen, 80kD), X-ray repair cross-complementing protein 5, X-ray repair, complementing defective, repair in Chinese hamster | |
| Rabbit | |
| 83 kDa | |
| 100 μL | |
| Cancer, Chromatin Research, Core ESC Like Genes, DNA Double Strand Break Repair, DNA Repair, Non homologous end joining, Stem Cell Markers | |
| 7520 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| 1 mg/ml | |
| Western Blot 1.0 ug/ml | |
| Q4VBQ5 | |
| XRCC5 | |
| Synthetic peptides corresponding to XRCC5 (X-ray repair complementing defective repair in Chinese hamster cells 5 (double-strand-break rejoining; 80kDa)) The peptide sequence was selected from the C terminal of XRCC5. Peptide sequence GITLITKEEASGSSVTAEEAKKFLAPKDKPSGDTAAVFEEGGDVDDLLDM The peptide sequence for this immunogen was taken from within the described region. | |
| Protein A purified | |
| RUO | |
| Primary | |
| Expected identity based on immunogen sequence: Xenopus: 84%; Chicken: 84%. | |
| Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction