Kv1.1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP317729100UL

Catalog No. NB159488

Description

Kv1.1 Polyclonal antibody specifically detects Kv1.1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: Kv1.1
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Alias: AEMK, EA1, HBK1, HUK1, Kv1.1, MBK1, MGC126782, MGC138385, MK1, potassium voltage-gated channel subfamily A member 1, potassium voltage-gated channel, shaker-related subfamily, member 1 (episodicataxia with myokymia), RBK1, Voltage-gated K(+) channel HuKI, Voltage-gated potassium channel HBK1, Voltage-gated potassium channel subunit Kv1.1
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: QLLHVSSPNLASDSDLSRRSSSTMSKSEYMEIEEDMNNSIAHYRQVNIRTANCTTANQNCVNKSKLLTD
• Quantity: 100 μg
• Research Discipline: Neurodegeneration, Neuroscience
• Gene ID (Entrez): 3736
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified