KV1.3 (KCNA3) Polyclonal Antibody, Invitrogen™

Rabbit Polyclonal Antibody

Supplier:  Thermo Scientific PA577571

Catalog No. PIPA577571

Description

Product is shipped at room temperature as a lyophilized powder and should be stored at -20 °C upon receipt. Reconstitution: add 50 μL of deionized water.

In neurons voltage-dependent potassium channels are key determits of the resting membrane potential and of membrane excitability, conditioning the frequency, and shape of action potential.

Specifications

• Antigen: KV1.3 (KCNA3)
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: KCNA3
• Gene Alias: Kcna3
• Host Species: Rabbit
• Purification Method: Antigen affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 16491, 29731, 3738
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Frozen), Immunoprecipitation, Western Blot
• Concentration: 0.6 mg/mL
• Formulation: PBS with 1% BSA, 5% sucrose and 0.05% sodium azide; pH 7.4
• Gene Accession No.: P15384, P16390, P22001
• Gene Symbols: Kcna3
• Immunogen: GST fusion protein with sequence TLSKSEYMVIEEGGMNHSAFPQTPFKTGNSTATCTTNNNPNSCVNIKKIFTDV, corresponding to amino acid residues 523-575 of human Kv 1.3
• Quantity: 50 μL
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody
• Isotype: IgG