Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Kv11.1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP310366100UL
Description
Kv11.1 Polyclonal specifically detects Kv11.1 in Human samples. It is validated for Western Blot.Specifications
Kv11.1 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
Eag homolog, Eag-related protein 1, ERG, erg1, ERG-1, Ether-a-go-go-related gene potassium channel 1, ether-a-go-go-related potassium channel protein, Ether-a-go-go-related protein 1, H-ERG, HERG1, HERGhERG-1, Kv11.1, LQT2, potassium voltage-gated channel subfamily H member 2, potassium voltage-gated channel, subfamily H (eag-related), member 2, SQT1, Voltage-gated potassium channel subunit Kv11.1 | |
The immunogen is a synthetic peptide directed towards the C-terminal region of human Kv11.1 (NP_742054). Peptide sequence SQVSQFMACEELPPGAPELPQEGPTRRLSLPGQLGALTSQPLHRHGSDPG | |
100 μg | |
Neuroscience, Neurotransmission, Potassium Channels | |
3757 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction