Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Kv12.2 Antibody, Novus Biologicals™
SDP

Catalog No. NB438060 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.1 mL
25ul
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB438060 25ul
NBP214142 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB438060 Supplier Novus Biologicals Supplier No. NBP21414225UL
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

Kv12.2 Polyclonal specifically detects Kv12.2 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen Kv12.2
Applications Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:500-1:1000
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias BEC1, brain-specific eag-like channel 1, ELK channel 2, ELK2, ether-a-go-go K(+) channel family member, ether-a-go-go-like potassium channel 2, KIAA1282, Kv12.2, potassium voltage-gated channel subfamily H member 3, potassium voltage-gated channel, subfamily H (eag-related), member 3, voltage-gated potassium channel subunit Kv12.2
Gene Symbols KCNH3
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the amino acids: EVDTSSLSGDNTLMSTLEEKETDGEQGPTVSPAPADEPSSPLLSPGCTSSSSAAKLLSPRRTAPRPRLGGRGRPGRAGALK
Purification Method Affinity Purified
Quantity 25ul
Regulatory Status RUO
Research Discipline Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 23416
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.