Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Kv12.2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP21414225UL
Description
Kv12.2 Polyclonal specifically detects Kv12.2 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
Kv12.2 | |
Polyclonal | |
Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:500-1:1000 | |
BEC1, brain-specific eag-like channel 1, ELK channel 2, ELK2, ether-a-go-go K(+) channel family member, ether-a-go-go-like potassium channel 2, KIAA1282, Kv12.2, potassium voltage-gated channel subfamily H member 3, potassium voltage-gated channel, subfamily H (eag-related), member 3, voltage-gated potassium channel subunit Kv12.2 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
KCNH3 | |
This antibody was developed against a recombinant protein corresponding to the amino acids: EVDTSSLSGDNTLMSTLEEKETDGEQGPTVSPAPADEPSSPLLSPGCTSSSSAAKLLSPRRTAPRPRLGGRGRPGRAGALK | |
25ul | |
Signal Transduction | |
23416 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction