Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Kv6.4 Rabbit anti-Rat, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | Kv6.4 |
---|---|
Dilution | Western Blot 1.0 ug/ml |
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
Kv6.4 Polyclonal specifically detects Kv6.4 in Rat samples. It is validated for Western Blot.Specifications
Kv6.4 | |
Western Blot | |
Unconjugated | |
Rabbit | |
Rat | |
KV6.3, KV6.4, MGC129609, potassium voltage-gated channel, subfamily G, member 4, voltage-gated potassium channel Kv6.3, voltage-gated potassium channel subunit Kv6.4 | |
The immunogen is a synthetic peptide directed towards the middle region of RAT Kv6.4 (NP_001100905). Peptide sequence SDESPEAGERPSGSSYLEKVGLVLRVLRALRILYVMRLARHSLGLQTLGL | |
Affinity purified |
Western Blot 1.0 ug/ml | |
Polyclonal | |
Purified | |
RUO | |
PBS buffer, 2% sucrose | |
93107 | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title