Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

LACC1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP17952320 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP17952320 20 μL
NBP179523 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP17952320 Supplier Novus Biologicals Supplier No. NBP17952320UL

Rabbit Polyclonal Antibody

LACC1 Polyclonal specifically detects LACC1 in Mouse samples. It is validated for Western Blot, Immunoprecipitation.

Specifications

Antigen LACC1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:1000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. NP_766076
Gene Alias chromosome 13 open reading frame 31, DKFZp686D11119, FLJ38725, hypothetical protein LOC144811
Gene Symbols LACC1
Host Species Rabbit
Immunogen The specific Immunogen is proprietary information. Peptide sequence LERGGILPQNIQDQKEDLDLCTSCHPEKFFSHVRDGLNFGTQIGFISLRE.
Molecular Weight of Antigen 47 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 144811
Target Species Mouse
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.