Lactate Dehydrogenase B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP238131

Catalog No. NBP238131

Description

Lactate Dehydrogenase B Polyclonal specifically detects Lactate Dehydrogenase B in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Lactate Dehydrogenase B
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 μg/mL, ELISA, Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Gene Accession No.: P07195
• Gene Symbols: LDHB
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: HPVSTMVKGMYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKDLKDL
• Quantity: 0.1 mL
• Research Discipline: HIF Target Genes, Hypoxia, Mitochondrial Mediated Pathway
• Gene ID (Entrez): 3945
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: EC 1.1.1, EC 1.1.1.27, lactate dehydrogenase B, LDH heart subunit, LDH-B, LDH-H, L-lactate dehydrogenase B chain, Renal carcinoma antigen NY-REN-46, TRG-5
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.