Lactoferrin Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP23888525UL

Catalog No. NB404627

Description

Lactoferrin Polyclonal specifically detects Lactoferrin in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Lactoferrin
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:2500 - 1:5000
• Gene Accession No.: P02788
• Gene Symbols: LTF
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: PNHAVVSRMDKVERLKQVLLHQQAKFGRNGSDCPDKFCLFQSETKNLLFNDNTECLARLHGK
• Quantity: 25 μL
• Research Discipline: Amino Acids Drugs and other small molecules
• Gene ID (Entrez): 4057
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: EC 3.4.21, EC 3.4.21.-, GIG12, growth-inhibiting protein 12, HLF2, Lactoferrin, lactotransferrin, LF, neutrophil lactoferrin, talalactoferrin
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.