Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Lactoferrin Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | Lactoferrin |
---|---|
Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:2500 - 1:5000 |
Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
Lactoferrin Polyclonal specifically detects Lactoferrin in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
Lactoferrin | |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
Human | |
P02788 | |
4057 | |
This antibody was developed against a recombinant protein corresponding to amino acids: PNHAVVSRMDKVERLKQVLLHQQAKFGRNGSDCPDKFCLFQSETKNLLFNDNTECLARLHGK | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Immunohistochemistry, Immunohistochemistry-Paraffin 1:2500 - 1:5000 | |
Polyclonal | |
Rabbit | |
Amino Acids Drugs and other small molecules | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
EC 3.4.21, EC 3.4.21.-, GIG12, growth-inhibiting protein 12, HLF2, Lactoferrin, lactotransferrin, LF, neutrophil lactoferrin, talalactoferrin | |
LTF | |
IgG | |
Affinity Purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title