Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PIPA568961

Invitrogen™ LAF4 Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA568961
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA568961 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA568961 Supplier Invitrogen™ Supplier No. PA568961
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

This target displays homology in the following species: Cow: 93%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85% Synthetic peptide located within the following region: TNSILHSYDYWEMADNLAKENREFFNDLDLLMGPVTLHSSMEHLVQYSQQ.

This gene encodes a tissue-restricted nuclear transcriptional activator that is preferentially expressed in lymphoid tissue. Isolation of this protein initially defined a highly conserved LAF4/MLLT2 gene family of nuclear transcription factors that may function in lymphoid development and oncogenesis. In some ALL patients, this gene has been found fused to the gene for MLL. Multiple alternatively spliced transcript variants that encode different proteins have been found for this gene.
TRUSTED_SUSTAINABILITY

Specifications

Antigen LAF4
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/mL
Conjugate Unconjugated
Formulation PBS with 2% sucrose and 0.09% sodium azide
Gene AFF3
Gene Accession No. P51827
Gene Alias 3222402O04Rik; A730046J16; AF4/FMR2 family member 3; AF4/FMR2 family, member 3; AFF3; id:ibd5053; LAF4; LAF-4; lymphoid nuclear protein 4; lymphoid nuclear protein related to AF4; MLLT2-like; MLLT2-related protein; protein LAF-4; si:dkey-19j7.2
Gene Symbols AFF3
Host Species Rabbit
Immunogen synthetic peptide directed towards the middle region of human LAF4 (aa 1193-1242).
Purification Method Affinity chromatography
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 16764
Target Species Mouse
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Product Type Antibody
Form Liquid
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.