Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

LAIR1 Rabbit anti-Human, Polyclonal , Abnova™

Rabbit polyclonal antibody raised against partial recombinant human LAIR1.

Manufacturer:  Abnova Corporation PAB29577

Catalog No. 89-934-451


Add to cart

Description

Description

The protein encoded by this gene is an inhibitory receptor found on peripheral mononuclear cells, including NK cells, T cells, and B cells. Inhibitory receptors regulate the immune response to prevent lysis of cells recognized as self. The gene is a member of both the immunoglobulin superfamily and the leukocyte-associated inhibitory receptor family. The gene maps to a region of 19q13.4 called the leukocyte receptor cluster, which contains at least 29 genes encoding leukocyte-expressed receptors of the immunoglobulin superfamily. [provided by RefSeq]

Sequence: HRQNQIKQGPPRSKDEEQKPQQRPDLAVDVLERTADKATVNGLPEKDRETDTSALAAGSSQEVTYAQLDHWALTQRTARAVSPQSTKPMAESITYAAVARH
Specifications

Specifications

LAIR1
Unconjugated
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500) Western Blot (1:100-1:250) The optimal working dilution should be determined by the end user.
Liquid
LAIR1
Recombinant protein corresponding to amino acids 187-287 of human LAIR1.
Antigen affinity purification
RUO
Primary
3903
Immunohistochemistry (PFA fixed), Western Blot
Rabbit polyclonal antibody raised against partial recombinant human LAIR1.
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
CD305/LAIR-1
Rabbit
IgG
100 uL
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Polyclonal
Human
SDS
Documents
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit