Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Laminin gamma 1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication
$646.00
Specifications
Antigen | Laminin gamma 1 |
---|---|
Dilution | Western Blot 0.04 - 0.4 ug/ml, Simple Western 1:20, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200-1:500 |
Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
Laminin gamma 1 Polyclonal specifically detects Laminin gamma 1 in Human, Mouse samples. It is validated for Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
Laminin gamma 1 | |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
Human, Mouse | |
LAMB2Laminin-7 subunit gamma, Laminin B2 chain, laminin subunit gamma-1, laminin, gamma 1 (formerly LAMB2), Laminin-1 subunit gamma, Laminin-10 subunit gamma, Laminin-11 subunit gamma, Laminin-2 subunit gamma, Laminin-3 subunit gamma, Laminin-4 subunit gamma, Laminin-6 subunit gamma, Laminin-8 subunit gamma, Laminin-9 subunit gamma, MGC87297, S-LAM gamma, S-laminin subunit gamma | |
LAMC1 | |
IgG | |
Affinity Purified | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Western Blot 0.04 - 0.4 ug/ml, Simple Western 1:20, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200-1:500 | |
Polyclonal | |
Rabbit | |
Apoptosis, Cancer, Cytoskeleton Markers, Extracellular Matrix, Tumor Suppressors | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
3915 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:STKAEAERTFAEVTDLDNEVNNMLKQLQEAEKELKRKQDDADQDMMMAGMASQAAQEAEINARKAKNSVTSLLSIINDLLEQLGQLDTVDLNKLNEIEGTLNKAKDEMKVS | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title