Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

LAMP-1/CD107a Antibody (CL3484), Novus Biologicals™
SDP

Catalog No. p-200081036 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP259780 100 μL
NB393139 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP259780 Supplier Novus Biologicals Supplier No. NBP259780
Only null left
Add to Cart
Add to Cart

Mouse Monoclonal Antibody

LAMP-1/CD107a Monoclonal specifically detects LAMP-1/CD107a in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen LAMP-1/CD107a
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Monoclonal
Clone CL3484
Conjugate Unconjugated
Dilution Western Blot 1 μg/mL, Immunohistochemistry 1:5000 - 1:10000, Immunohistochemistry-Paraffin 1:5000 - 1:10000
Formulation PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias CD107 antigen-like family member A, CD107a, CD107a antigen, LAMP-1, LAMPA, LGP120, lysosomal-associated membrane protein 1, lysosome-associated membrane glycoprotein 1, Lysosome-associated membrane protein 1
Gene Symbols LAMP1
Host Species Mouse
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: NFSAAFSVNYDTKSGPKNMTFDLPSDATVVLNRSSCGKENTSDPSLVIAFGRGHTLTLNFTRNATRYSVQLMSFVYNLSDTHLFPNASSKEIKTVESITDIRADIDKKYRCVSGTQVHMNNVTVTLHDA
Purification Method Protein A purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Autophagy, Cholesterol Metabolism, Endosome Markers, Glycobiology, Lysosome Markers, Mast Cell Markers, Membrane Trafficking and Chaperones, Virology Bacteria and Parasites
Primary or Secondary Primary
Gene ID (Entrez) 3916
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a
Show More Show Less

For Research Use Only (RUO)

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.