LAPTM5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB438039	Novus Biologicals NBP21418325UL	25ul
NBP214183	Novus Biologicals NBP214183	0.1 mL

Description

LAPTM5 Polyclonal specifically detects LAPTM5 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: LAPTM5
• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 7805
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: IKCMNSVEEKRNSKMLQKVVLPSYEEALSLPSKTP
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human
• Gene Alias: CD40-ligand-activated specific transcripts, CLAST6, FLJ61683, FLJ97251, human retinoic acid-inducible E3 protein, KIAA0085, lysosomal associated multispanning membrane protein 5, lysosomal multispanning membrane protein 5, lysosomal protein transmembrane 5, Lysosomal-associated multitransmembrane protein 5, lysosomal-associated transmembrane protein 5, MGC125860, MGC125861, Retinoic acid-inducible E3 protein
• Gene Symbols: LAPTM5
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only