Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
LARP7 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | LARP7 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Form | Purified |
Description
LARP7 Polyclonal specifically detects LARP7 in Human samples. It is validated for Western Blot.Specifications
LARP7 | |
Polyclonal | |
Purified | |
RUO | |
51574 | |
Synthetic peptides corresponding to LARP7 (La ribonucleoprotein domain family, member 7) The peptide sequence was selected from the C terminal of LARP7. Peptide sequence HCWKLEILSGDHEQRYWQKILVDRQAKLNQPREKKRGTEKLITKAEKIRL. | |
Primary |
Western Blot | |
Unconjugated | |
Rabbit | |
DKFZp564K112, HDCMA18P, La ribonucleoprotein domain family member 7, La ribonucleoprotein domain family, member 7, la-related protein 7, PIP7SMGC104360, P-TEFb-interaction protein for 7SK stability | |
LARP7 | |
IgG | |
Protein A purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title