Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
LAS2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP17952520UL
Description
LAS2 Polyclonal specifically detects LAS2 in Human samples. It is validated for Western Blot.Specifications
| LAS2 | |
| Polyclonal | |
| Western Blot 1:1000 | |
| EAW63006.1 | |
| C18ORF54 | |
| Synthetic peptide directed towards the middle region of human C18orf54The immunogen for this antibody is C18ORF54. Peptide sequence PCSLDKLEADRSWENIPVTFKSPVPVNSDDSPQQTSRAKSAKGVLEDFLN. | |
| 20 μL | |
| Primary | |
| Human | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| C18orf54, chromosome 18 open reading frame 54, hypothetical protein LOC162681, LAS2, MGC33382 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 162681 | |
| Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction