Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
LAS2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$158.00 - $487.50
Specifications
| Antigen | LAS2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP17952520
|
Novus Biologicals
NBP17952520UL |
20 μL |
Each for $158.00
|
|
|||||
|
NBP179525
|
Novus Biologicals
NBP179525 |
100 μL |
Each for $487.50
|
|
|||||
Description
LAS2 Polyclonal specifically detects LAS2 in Human samples. It is validated for Western Blot.Specifications
| LAS2 | |
| Polyclonal | |
| Rabbit | |
| EAW63006.1 | |
| 162681 | |
| Synthetic peptide directed towards the middle region of human C18orf54The immunogen for this antibody is C18ORF54. Peptide sequence PCSLDKLEADRSWENIPVTFKSPVPVNSDDSPQQTSRAKSAKGVLEDFLN. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| C18orf54, chromosome 18 open reading frame 54, hypothetical protein LOC162681, LAS2, MGC33382 | |
| C18ORF54 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title