Novus Biologicals™ LC3C Recombinant Protein Antigen

Description

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LC3C. Source: E.coli Amino Acid Sequence: TKFLVPQELTMTQFLSIIRSRMVLRATEAF The LC3C Recombinant Protein Antigen is derived from E. coli. The LC3C Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

Specifications

• Gene ID (Entrez): 440738
• Purification Method: >80% by SDS-PAGE and Coomassie blue staining
• Common Name: LC3C Recombinant Protein Antigen
• Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
• Formulation: PBS and 1M Urea, pH 7.4
• For Use With (Application): Blocking/Neutralizing, Control
• Gene Alias: ATG8J, Autophagy-related protein LC3 C, Autophagy-related ubiquitin-like modifier LC3 C, LC3C, LC3-like protein 2, MAP1 light chain 3-like protein 2, MAP1 light chain 3-like protein 3, MAP1A/MAP1B LC3 C, microtubule-associated protein 1 light chain 3 gamm
• Gene Symbol: MAP1LC3C
• Label Type: Unlabeled
• Product Type: Recombinant Protein Antigen
• Quantity: 100 μL
• Regulatory Status: RUO
• Source: E.coli
• Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53370. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml

For research use only.