Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Life Sciences
  4. Protein Biology
  5. Proteins
  6. Proteins A-Z
  7. Proteins L
  8. NBP257604PE

Novus Biologicals™ LC3C Recombinant Protein Antigen

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

Manufacturer:  Novus Biologicals™ NBP257604PEP

Catalog No. NBP257604PE


Add to cart

Description

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LC3C. Source: E.coli Amino Acid Sequence: TKFLVPQELTMTQFLSIIRSRMVLRATEAF The LC3C Recombinant Protein Antigen is derived from E. coli. The LC3C Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Specifications

Specifications

Blocking/Neutralizing, Control
440738
>80% by SDS-PAGE and Coomassie blue staining
E.coli
RUO
MAP1LC3C
Unlabeled
Yes
PBS and 1M Urea, pH 7.4
LC3C Recombinant Protein Antigen
100μL
Store at −20°C. Avoid freeze-thaw cycles
ATG8J, Autophagy-related protein LC3 C, Autophagy-related ubiquitin-like modifier LC3 C, LC3C, LC3-like protein 2, MAP1 light chain 3-like protein 2, MAP1 light chain 3-like protein 3, MAP1A/MAP1B LC3 C, microtubule-associated protein 1 light chain 3 gamm
Recombinant Protein Antigen
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For research use only.