Invitrogen™ LCK Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA579587

Catalog No. PIPA579587

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human Jurkat whole cell, mouse spleen tissue, mouse thymus tissue. IHC: mouse lymphaden tissue, rat lymphaden tissue, human tonsil tissue IHC-F: mouse spleen tissue. ICC/IF: U20S cell. Flow: HepG2 cell.

LCK is a member of the Src-family tyrosine kinase, which are essential for signaling through the T-cell receptor (TCR) complex. Upon TCR triggering, LCK phosphorylates the ITAM motives in its zeta subunits establishing binding sites for the SH2 domains of the tyrosine kinase ZAP70, which is also phosphorylated by LCK and activated to generate subsequent signaling platforms by phosphorylation of adaptor LAT. The majority of LCK is localized to the plasma membrane, however, there is also a significant fraction associated with the Golgi apparatus which may contribute to Raf activation under conditions of weak stimulation through the TCR. LCK contains N-terminal sites for myristylation and palmitylation, a PTK domain, and SH2 and SH3 domains which are involved in mediating protein-protein interactions with phosphotyrosine-containing and proline-rich motifs, respectively. LCK is also involved in the regulation of apoptosis induced by various stimuli, but not by the death receptors. Diseases associated with LCK include Immunodeficiency 22 and CD45 deficiency. Alternatively splice variants of the LCK gene encoding different isoforms of the protein have been found.

Specifications

• Antigen: LCK
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: LCK
• Gene Alias: EC 2.7.10.2; Hck-3; IMD22; kinase Lck; Lck; LCK proto-oncogene, Src family tyrosine kinase; Lck1; Lcktkr; leukocyte C-terminal Src kinase; LSK; Lskt; Lsk-t; Lymphocyte cell-specific protein-tyrosine kinase; lymphocyte protein tyrosine kinase; lymphocyte-specific protein tyrosine kinase; OTTHUMP00000008640; OTTHUMP00000008740; OTTHUMP00000008741; p56(LSTRA) protein-tyrosine kinase; p56>lck>; p56lck; p56-LCK; pp58lck; Protein YT16; Proto-oncogene Lck; Proto-oncogene tyrosine-protein kinase LCK; RP4-675E8.4; t cell-specific protein-tyrosine kinase; T-lymphocyte specific protein tyrosine kinase p56lck; tyr; tyrosine-protein kinase Lck; YT16
• Host Species: Rabbit
• Purification Method: Antigen Affinity Chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 16818, 313050, 3932
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Flow Cytometry, Immunohistochemistry (Frozen), Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry
• Concentration: 500 μg/mL
• Formulation: PBS with 4mg trehalose and no preservative
• Gene Accession No.: P06239, P06240, Q01621
• Gene Symbols: LCK
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Lck (468-506aa ELYQLMRLCWKERPEDRPTFDYLRSVLEDFFTATEGQYQ).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody
• Isotype: IgG