Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
LCN12 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$480.74
Specifications
| Antigen | LCN12 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
LCN12 Polyclonal specifically detects LCN12 in Human samples. It is validated for Western Blot.Specifications
| LCN12 | |
| Polyclonal | |
| Rabbit | |
| Lipid and Metabolism | |
| epididymal-specific lipocalin-12, lipocalcin 12, lipocalin 12, MGC34753, MGC48935 | |
| LCN12 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q8IW14 | |
| 286256 | |
| Synthetic peptides corresponding to LCN12(lipocalin 12) The peptide sequence was selected from the N terminal of LCN12. Peptide sequence GNQFQGEWFVLGLAGNSFRPEHRALLNAFTATFELSDDGRFEVWNAMTRG. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title