Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
LCN12 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | LCN12 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
LCN12 Polyclonal specifically detects LCN12 in Human samples. It is validated for Western Blot.Specifications
LCN12 | |
Polyclonal | |
Rabbit | |
Lipid and Metabolism | |
epididymal-specific lipocalin-12, lipocalcin 12, lipocalin 12, MGC34753, MGC48935 | |
LCN12 | |
IgG |
Western Blot | |
Unconjugated | |
RUO | |
Q8IW14 | |
286256 | |
Synthetic peptides corresponding to LCN12(lipocalin 12) The peptide sequence was selected from the N terminal of LCN12. Peptide sequence GNQFQGEWFVLGLAGNSFRPEHRALLNAFTATFELSDDGRFEVWNAMTRG. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title