Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
LCN8 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | LCN8 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
LCN8 Polyclonal specifically detects LCN8 in Human samples. It is validated for Western Blot.Specifications
LCN8 | |
Polyclonal | |
Rabbit | |
Human | |
chromosome 9 open reading frame 137, EP17, epididymal-specific lipocalin-8, LCN5, lipocalin 5, lipocalin 8 | |
LCN8 | |
IgG |
Western Blot | |
Unconjugated | |
RUO | |
A1L4A8 | |
138307 | |
Synthetic peptides corresponding to LCN8(lipocalin 8) The peptide sequence was selected from the N terminal of LCN8. Peptide sequence EELDRQKIGGFWREVGVASDQSLVLTAPKRVEGLFLTLSGSNLTVKVAYN. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title