Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
LCoR Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | LCoR |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
LCoR Polyclonal specifically detects LCoR in Human samples. It is validated for Western Blot.Specifications
LCoR | |
Polyclonal | |
Rabbit | |
Q96JN0 | |
84458 | |
Synthetic peptides corresponding to LCOR (ligand dependent nuclear receptor corepressor) The peptide sequence was selected from the C terminal of LCOR. Peptide sequence EGDPGSKQPRKKRGRYRQYNSEILEEAISVVMSGKMSVSKAQSIYGIPHS. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
FLJ38026, KIAA1795RP11-175O19.1, LCoR, ligand dependent nuclear receptor corepressor, Mblk1-related protein 2, MLR2ligand-dependent corepressor | |
LCOR | |
IgG | |
47 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title