Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
LDHD Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$499.50
Specifications
Antigen | LDHD |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
LDHD Polyclonal specifically detects LDHD in Human samples. It is validated for Western Blot.Specifications
LDHD | |
Polyclonal | |
Rabbit | |
Q86WU2 | |
197257 | |
Synthetic peptides corresponding to LDHD(lactate dehydrogenase D) The peptide sequence was selected from the middle region of LDHD. Peptide sequence LLVNPDDAEELGRVKAFAEQLGRRALALHGTCTGEHGIGMGKRQLLQEEV. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
D-lactate dehydrogenase, EC 1.1.2.4, lactate dehydrogenase DDLD, MGC57726, probable D-lactate dehydrogenase, mitochondrial | |
LDHD | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title