Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ LGALS3BP Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA579597
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA579597 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA579597 Supplier Invitrogen™ Supplier No. PA579597
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human Hela whole cell, human 293T whole cell, human HepG2 whole cell, rat brain tissue, mouse brain tissue. IHC: human mammary cancer tissue, human intestinal cancer tissue, human placenta tissue, mouse small intestine tissue, human lung cancer tissue.

The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. LGALS3BP has been found elevated in the serum of patients with cancer and in those infected by the human immunodeficiency virus (HIV). It appears to be implicated in immune response associated with natural killer (NK) and lymphokine-activated killer (LAK) cell cytotoxicity. Using fluorescence in situ hybridization the full length 90K cDNA has been localized to chromosome 17q25. The native protein binds specifically to a human macrophage-associated lectin known as Mac-2 and also binds galectin 1.
TRUSTED_SUSTAINABILITY

Specifications

Antigen LGALS3BP
Applications Immunohistochemistry (Paraffin), Western Blot
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 4mg trehalose and 0.05mg sodium azide
Gene LGALS3BP
Gene Accession No. O70513, Q07797, Q08380
Gene Alias 90K; basement membrane autoantigen p105; BTBD17B; CyCAP; Cyp-C-associated protein; galectin 3 binding protein; galectin-3-binding protein; gp90; L3 antigen; Lectin; lectin galactoside-binding soluble 3 binding protein; lectin galactoside-binding soluble 3-binding protein; lectin, galactoside binding soluble 3 binding protein; lectin, galactoside-binding, soluble, 3 binding protein; Lgals3bp; M2BP; mac-2 BP; mac-2-binding protein; MAC2BP; MAC-2BP; MAC-2-BP; mama; peptidylprolyl isomerase C-associated protein; Ppicap; Protein 90K; Protein MAMA; serum protein 90K; similar to Galectin-3 binding protein precursor (Lectin galactoside-binding soluble 3 binding protein) (Mac-2 binding protein) (Mac-2 BP) (MAC2BP) (Tumor-associated antigen 90K); TANGO10B; transport and golgi organization 10 homolog B; tumor-associated antigen 90K
Gene Symbols LGALS3BP
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence of human LGALS3BP (HEALFQKKTLQALEFHTVPFQLLARYKGLNLTEDTYKPR).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 19039, 245955, 3959
Target Species Human, Mouse, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.