Invitrogen™ LGALS3BP Polyclonal Antibody

Catalog No.	Quantity
PIPA579597	100 μg

Catalog No. PIPA579597 Supplier Invitrogen™ Supplier No. PA579597

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human Hela whole cell, human 293T whole cell, human HepG2 whole cell, rat brain tissue, mouse brain tissue. IHC: human mammary cancer tissue, human intestinal cancer tissue, human placenta tissue, mouse small intestine tissue, human lung cancer tissue.

The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. LGALS3BP has been found elevated in the serum of patients with cancer and in those infected by the human immunodeficiency virus (HIV). It appears to be implicated in immune response associated with natural killer (NK) and lymphokine-activated killer (LAK) cell cytotoxicity. Using fluorescence in situ hybridization the full length 90K cDNA has been localized to chromosome 17q25. The native protein binds specifically to a human macrophage-associated lectin known as Mac-2 and also binds galectin 1.

Specifications

• Antigen: LGALS3BP
• Applications: Immunohistochemistry (Paraffin), Western Blot
• Classification: Polyclonal
• Concentration: 500 μg/mL
• Conjugate: Unconjugated
• Formulation: PBS with 4mg trehalose and 0.05mg sodium azide
• Gene: LGALS3BP
• Gene Accession No.: O70513, Q07797, Q08380
• Gene Alias: 90K; basement membrane autoantigen p105; BTBD17B; CyCAP; Cyp-C-associated protein; galectin 3 binding protein; galectin-3-binding protein; gp90; L3 antigen; Lectin; lectin galactoside-binding soluble 3 binding protein; lectin galactoside-binding soluble 3-binding protein; lectin, galactoside binding soluble 3 binding protein; lectin, galactoside-binding, soluble, 3 binding protein; Lgals3bp; M2BP; mac-2 BP; mac-2-binding protein; MAC2BP; MAC-2BP; MAC-2-BP; mama; peptidylprolyl isomerase C-associated protein; Ppicap; Protein 90K; Protein MAMA; serum protein 90K; similar to Galectin-3 binding protein precursor (Lectin galactoside-binding soluble 3 binding protein) (Mac-2 binding protein) (Mac-2 BP) (MAC2BP) (Tumor-associated antigen 90K); TANGO10B; transport and golgi organization 10 homolog B; tumor-associated antigen 90K
• Gene Symbols: LGALS3BP
• Host Species: Rabbit
• Immunogen: A synthetic peptide corresponding to a sequence of human LGALS3BP (HEALFQKKTLQALEFHTVPFQLLARYKGLNLTEDTYKPR).
• Purification Method: Antigen affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 19039, 245955, 3959
• Target Species: Human, Mouse, Rat
• Content And Storage: -20°C
• Product Type: Antibody
• Form: Lyophilized
• Isotype: IgG