Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Lgr5/GPR49 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP254660
Description
Lgr5/GPR49 Polyclonal specifically detects Lgr5/GPR49 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| Lgr5/GPR49 | |
| Polyclonal | |
| Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| FEX, G protein-coupled receptor 49, GPR49G-protein coupled receptor HG38, GPR67, G-protein coupled receptor 49, G-protein coupled receptor 67, GRP49, HG38, leucine-rich repeat containing G protein-coupled receptor 5, leucine-rich repeat-containing G protein-coupled receptor 5, leucine-rich repeat-containing G-protein coupled receptor 5, MGC117008, orphan G protein-coupled receptor HG38 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| LGR5 | |
| This antibody was developed against a Recombinant Protein corresponding to amino acids:AIIHPNAFSTLPSLIKLDLSSNLLSSFPITGLHGLTHLKLTGNHALQSLISSENFPELKVIEMPYAYQCCAFGVCENAYKISNQWNKGDNSSMDDLHKKDAGMFQAQDERDLEDFLLDFEEDLKALHSVQCSPSPGPFKPCEHLLDG | |
| 100 μL | |
| Cancer, GPCR, Neuroscience, Signal Transduction, Wnt Signaling Pathway | |
| 8549 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction