Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
LGTN Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$480.74
Specifications
| Antigen | LGTN |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
LGTN Polyclonal specifically detects LGTN in Human samples. It is validated for Western Blot.Specifications
| LGTN | |
| Polyclonal | |
| Rabbit | |
| P41214 | |
| 1939 | |
| Synthetic peptides corresponding to eIF2D. The peptide sequence was selected from the middle region of eIF2D. Peptide sequence KVTVVRNLEAYGLDPYSVAAILQQRCQASTTVNPAPGAKDSLQVQIQGNQ. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| eukaryotic translation initiation factor 2D, HCA56eIF2d, Hepatocellular carcinoma-associated antigen 56, LGTNLigatin, ligatin | |
| EIF2D | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title